collapse temperature raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2026-03-29. Anything still debated is marked as such rather than presented as settled.
Analytical methods for lyophilized materials include X-ray diffraction for crystallinity, differential scanning calorimetry for thermal transitions, and scanning electron microscopy for pore morphology. Moisture sorption analysis shows how the cake responds to humidity. These methods help distinguish amorphous from crystalline states and detect phase changes. Open questions remain about how pore structure changes during long-term storage and how best to predict collapse under varied conditions. Comparisons across studies are complicated by differences in formulation, cycle, and storage history.
Quality control for lyophilized products focuses on appearance, moisture level, reconstitution time, and structural integrity. A cake should be uniform, intact, and free of meltback or collapse. Moisture level is measured by Karl Fischer titration or thermogravimetric analysis. Reconstitution time reflects pore structure and formulation. Visual inspection and vial integrity checks detect cracks, stopper defects, or particulate matter. These checks are often performed on samples from each batch. They help confirm that the drying cycle performed as intended.
Storage stability depends on water content, oxygen exposure, and temperature. Lyophilized solids are hygroscopic and can absorb water if exposed to humid air. Vials are usually sealed under vacuum or inert gas with rubber stoppers and aluminum crimps. Storage temperatures range from room temperature to refrigerated or frozen conditions depending on the material. Stability studies track potency, moisture, and physical form over time. Accelerated conditions can reveal sensitivity but may not predict long-term behavior.
Freezing is the first stage and sets the ice structure that later becomes the pore network. The formulation is cooled below its freezing point, often with a controlled ramp, and solutes concentrate as ice forms. Primary drying then lowers chamber pressure and supplies heat to sublime the ice. The product temperature must stay below its collapse or eutectic temperature to prevent structural loss. Secondary drying raises the temperature modestly to remove bound water and achieve a low residual moisture.
A freeze-dryer consists of a vacuum chamber, temperature-controlled shelves, a condenser, and a vacuum pump. Vials, ampoules, or bulk trays hold the product during the cycle. The condenser traps water vapor as ice at a temperature lower than the product. Cycle development balances shelf temperature, chamber pressure, and time. Scale-up can be difficult because heat and mass transfer change with equipment size, so process analytical tools and conservative validation are often used.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white porous cake | Color and texture vary with formulation. |
| Reconstitution time | Seconds to several minutes | Depends on cake porosity, excipients, and diluent. |
| Typical moisture level | 0.5-3% w/w | Lower values suit hydrolysis-sensitive materials. |
| Common moisture method | Karl Fischer titration | Coulometric mode is common for low water levels. |
| Typical storage temperature | 2-8 °C or ambient | Some products require frozen storage; protect from humidity. |
After drying, a lyophilized product is usually sealed under vacuum or an inert gas to limit moisture and oxygen exposure. The container closure system matters because stoppers and seals can allow moisture ingress over time. Storage conditions are selected from stability studies that track potency, cake appearance, and reconstitution behavior. Many freeze-dried materials are kept at controlled room temperature, while some require refrigeration or protection from light.
Quality control for freeze-dried forms includes visual inspection, water content measurement, and reconstitution time. A satisfactory cake is typically uniform, porous, and intact, although minor shrinkage or cracking may be acceptable if specifications allow. Karl Fischer titration, thermal gravimetric analysis, and near-infrared spectroscopy are used to measure water content. Reconstitution is assessed by adding a specified diluent and recording the time and ease of dissolution. Microbiological and particulate tests are added when the product is sterile or intended for injection.
Lyophilization removes water from a frozen material by sublimation under reduced pressure. The process begins with freezing, which converts liquid water into ice and fixes the structure of the sample. After freezing, primary drying lowers pressure so ice changes directly to vapor without passing through a liquid phase. Secondary drying then removes bound water that remains after ice sublimation. The result is a dry, porous solid that often retains its original shape.
The low pressure used during drying allows water vapor to move from the ice surface to a cold condenser. Energy supplied as heat drives sublimation but must stay below the collapse temperature of the frozen matrix. If the product becomes too warm, the frozen structure may soften or melt, reducing pore formation and slowing drying. Formulations often include bulking agents, stabilizers, or buffers to support a rigid cake. The final moisture content depends on formulation, freezing rate, and the length of secondary drying.
Freeze-drying is distinct from simple evaporation and from spray drying. Evaporation removes water at temperatures above freezing, while spray drying rapidly dries droplets in a heated gas stream. Lyophilization avoids high temperatures, which can be useful for heat-sensitive materials such as proteins, vaccines, and some foods. The porous cake produced by sublimation dissolves or rehydrates more quickly than a dense dried mass. Not all materials tolerate freezing or the pH shifts that can occur as solutes concentrate during ice formation.
=== Antiviral properties === Peppermint has been shown to suppress viruses such as Influenza A, herpes simplex virus (HSV), and Vaccinia virus in laboratory studies. Mint extracts can also limit viral replication in HIV‑1, the most common strain of HIV.
== Interactions == Meropenem rapidly reduces serum concentrations of valproic acid. As a result, people who use valproic acid for epilepsy are at increased risk of seizures during treatment with meropenem. In situations where the use of meropenem cannot be avoided, prescription of an additional anticonvulsant should be considered.
=== In classical mechanics === In classical mechanics, discrete spectra are often associated to waves and oscillations in a bounded object or domain. Mathematically they can be identified with the eigenvalues of differential operators that describe the evolution of some continuous variable (such as strain or pressure) as a function of time and/or space. Discrete spectra are also produced by some non-linear oscillators where the relevant quantity has a non-sinusoidal waveform. Notable examples are the sound produced by the vocal cords of mammals. and the stridulation organs of crickets, whose spectrum shows a series of strong lines at frequencies that are integer multiples (harmonics) of the oscillation frequency. A related phenomenon is the appearance of strong harmonics when a sinusoidal signal (which has the ultimate "discrete spectrum", consisting of a single spectral line) is modified by a non-linear filter; for example, when a pure tone is played through an overloaded amplifier, or when an intense monochromatic laser beam goes through a non-linear medium. In the latter case, if two arbitrary sinusoidal signals with frequencies f and g are processed together, the output signal will generally have spectral lines at frequencies |mf + ng|, where m and n are any integers.
== Types == Think tanks vary by ideological perspectives, sources of funding, topical emphasis and prospective consumers. Funding may also represent who or what the institution wants to influence; in the United States, for example, "Some donors want to influence votes in Congress or shape public opinion, others want to position themselves or the experts they fund for future government jobs, while others want to push specific areas of research or education." McGann distinguishes think tanks based on independence, source of funding and affiliation, grouping think tanks into autonomous and independent, quasi-independent, government affiliated, quasi-governmental, university affiliated, political-party affiliated or corporate. A new trend, resulting from globalization, is collaboration between policy institutes in different countries. For instance, the Carnegie Endowment for International Peace operates offices in Washington, D.C., Beijing, Beirut, Brussels and formerly in Moscow, where it was closed in April 2022. The Think Tanks and Civil Societies Program (TTCSP) at the University of Pennsylvania, led by James McGann, annually rated policy institutes worldwide through 2021 in a number of categories and presented its findings in the Global Go-To Think Tanks rating index. However, this method of the study and assessment of policy institutes has been criticized by researchers such as Enrique Mendizabal and Goran Buldioski, Director of the Think Tank Fund, assisted by the Open Society Institute.
Sources: en.wikipedia.org
== ECU Health Foundation == The ECU Health Foundation is an independent, non-profit, tax-exempt, charitable corporation that serves as the custodian for all financial gifts and bequests to ECU Health .
The two substrates of this enzyme are D-sorbitol 6-phosphate and oxidised nicotinamide adenine dinucleotide (NAD+). Its products are fructose 6-phosphate (shown in its open-chain form), reduced NADH, and a proton. This enzyme belongs to the family of oxidoreductases, specifically those acting on the CH-OH group of donor with NAD+ or NADP+ as acceptor. The systematic name of this enzyme class is D-sorbitol-6-phosphate:NAD+ 2-oxidoreductase. Other names in common use include ketosephosphate reductase, ketosephosphate reductase, D-sorbitol 6-phosphate dehydrogenase, D-sorbitol-6-phosphate dehydrogenase, sorbitol-6-P-dehydrogenase, and D-glucitol-6-phosphate dehydrogenase. This enzyme participates in fructose and mannose metabolism.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP.
Sources: en.wikipedia.org
It is then lowered by a strong rope over an outcrop of coral and the boat trawls over the coral causing it to break off and be caught in the netting. The device is then drawn to the surface by the boat crew.
In his 2011 paper Nature's Way of Making Audacious Space Projects Viable, he states that the Earth's non-renewable energy sources are nearly exhausted; natural gas will be depleted by 2020–2030, coal by 2035, uranium by 2056, while oil production peaked in 2006–2008. Nuclear energy cannot fully meet the world's energy needs (it represented only 6% in 2011). In addition, renewable energy cannot meet the growing demand for energy. Most of the minerals used by humans are in danger of becoming scarce; 11 minerals are already classified as having passed their peak production. For Metzger, humanity must therefore undertake a "100-year project" aimed at building a spacecraft ("100 Year Starship") capable of accessing the vast energy resources of the Solar System. For Metzger, it is even probable that if extraterrestrials coveted the energy resources of our Solar System, they would not look for them on Earth, but on the various asteroids and planetoids. Robotics is the only way to access so many dispersed resources, and humanity should embark on a second long-term project, which Metzger calls the "robotsphere", that would begin with the energetic exploitation of the Moon (estimated at 2.3×1012 J/year). This first step would make it possible to reach Type II in 53 years. Then the robotsphere (self-replicating and self-learning automated probes) would extend to the rest of the Solar System. Current advances in artificial intelligence suggest that the foundations of a robotsphere could be reached early in the next century, beginning in 2100.
Ultramicrotomy is a method of preparing extremely thin sections for transmission electron microscope (TEM) analysis. Tissues are commonly embedded in epoxy or other plastic resin. Very thin sections (less than 0.1 micrometer in thickness) are cut using diamond or glass knives on an ultramicrotome.
Sources: en.wikipedia.org
Karl Fischer titration is a common method, using coulometric or volumetric detection. Thermogravimetric analysis can also measure weight loss on heating. Results depend on sample handling because the dried solid can absorb moisture quickly.
The porous cake readily absorbs water vapor from air, which can reduce stability or cause collapse. Vials are sealed with stoppers and crimp seals, sometimes under vacuum or inert gas. Packaging also protects against oxygen and mechanical damage.
Collapse occurs when the product temperature rises above its collapse threshold during primary drying. The ice matrix loses structure, and the cake may shrink or melt back. Formulation excipients and freezing rate influence collapse threshold.
Yes, the terms are generally interchangeable. Lyophilization is more common in pharmaceutical and laboratory contexts, while freeze-drying appears widely in food science and general writing. Both describe removal of solvent by sublimation under vacuum after freezing.